PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.NB41M
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 245aa    MW: 26984.3 Da    PI: 9.6442
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.NB41MgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.42.9e-1295139347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W++eE+ l++ + ++lG+g+W+ I+r     Rt+ q+ s+ qky
      Aradu.NB41M  95 PWSQEEHRLFLIGLEKLGKGDWRGISRNYVVSRTPTQVASHAQKY 139
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.515319IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129417.5287144IPR017930Myb domain
TIGRFAMsTIGR015576.9E-1791142IPR006447Myb domain, plants
SuperFamilySSF466891.05E-1591144IPR009057Homeodomain-like
SMARTSM007172.8E-892142IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-1093138IPR009057Homeodomain-like
CDDcd001679.99E-995140No hitNo description
PfamPF002498.6E-1095139IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MNRRCSGCSK NGHNSRTCPY YSSSASRTTV TTVKLFGVRL SMTHGSGSCS AASPNHNSPF  60
SHYSSDGYVL DSEPSTPAAT INCHHPPPSI NKGIPWSQEE HRLFLIGLEK LGKGDWRGIS  120
RNYVVSRTPT QVASHAQKYF IRLRQSNATP RKRRSSLFDM FKNLASNSPS LKEEQVLLQP  180
SKNSQLSNVE EELNETIMVS NEATPASPLP GFFRPPYPAL PFSSWPSSAC SFGEATLILD  240
GRPLH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015938348.10.0PREDICTED: transcription factor MYB1R1-like
TrEMBLA0A151SHD35e-62A0A151SHD3_CAJCA; Myb-like protein J
STRINGGLYMA13G43120.12e-59(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2992022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-45MYB_related family protein